RPP38 Antibody
| Name | RPP38 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13260 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFED LSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPP38 Protein |
| Description | Rabbit Polyclonal |
| Gene | RPP38 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RPP38 Antibody [NBP2-13260] - Staining of human cell line U-2 OS shows positivity in nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23265_RPP38-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13260-img0003.jpg)
![Immunohistochemistry-Paraffin: RPP38 Antibody [NBP2-13260] - Staining of human fallopian tube shows moderate nucleolar positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23266_RPP38-Antibody-Immunohistochemistry-Paraffin-NBP2-13260-img0004.jpg)