RPL7A Antibody
| Name | RPL7A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13258 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPL7A Protein |
| Description | Rabbit Polyclonal |
| Gene | RPL7AP10 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RPL7A Antibody [NBP2-13258] - Staining of human cell line MCF-7 shows positivity in nucleoli & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23267_RPL7A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13258-img0003.jpg)
![Immunohistochemistry-Paraffin: RPL7A Antibody [NBP2-13258] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23268_RPL7A-Antibody-Immunohistochemistry-Paraffin-NBP2-13258-img0004.jpg)