SLC25A23 Antibody

Name SLC25A23 Antibody
Supplier Novus Biologicals
Catalog NBP2-13321
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDG GLD
Purity/Format Immunogen affinity purified
Blocking Peptide SLC25A23 Protein
Description Rabbit Polyclonal
Gene SLC25A23
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.