NET1 Antibody
| Name | NET1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13653 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSARKLTAQRRASTVSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQP GIRRARDKALSGGKRKETL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NET1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRPF38B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NET1 Antibody [NBP2-13653] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-380](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16134_NET1-Antibody-Western-Blot-NBP2-13653-img0003.jpg)
Western Blot: NET1 Antibody [NBP2-13653] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-380
![Immunocytochemistry/Immunofluorescence: NET1 Antibody [NBP2-13653] - Staining of human cell line HaCaT shows localization to nucleus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16135_NET1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13653-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NET1 Antibody [NBP2-13653] - Staining of human cell line HaCaT shows localization to nucleus & vesicles.
![Immunohistochemistry-Paraffin: NET1 Antibody [NBP2-13653] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16136_NET1-Antibody-Immunohistochemistry-Paraffin-NBP2-13653-img0001.jpg)
Immunohistochemistry-Paraffin: NET1 Antibody [NBP2-13653] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.