Tesmin Antibody
| Name | Tesmin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13624 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQ YQDQNNYLQSDVPKPMTALVG |
| Description | Rabbit Polyclonal |
| Gene | MTL5 |
| Supplier Page | Shop |
Product images
![Western Blot: Tesmin Antibody [NBP2-13624] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23398_Tesmin-Antibody-Western-Blot-NBP2-13624-img0004.jpg)
Western Blot: Tesmin Antibody [NBP2-13624] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: Tesmin Antibody [NBP2-13624] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23399_Tesmin-Antibody-Immunohistochemistry-Paraffin-NBP2-13624-img0001.jpg)
Immunohistochemistry-Paraffin: Tesmin Antibody [NBP2-13624] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.