TTC35 Antibody

Name TTC35 Antibody
Supplier Novus Biologicals
Catalog NBP2-13490
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: ELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWII YEQVMIAALDYGRDDLALFCLQELRRQFPGSH
Purity/Format Immunogen affinity purified
Blocking Peptide TTC35 Protein
Description Rabbit Polyclonal
Gene EMC2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.