TRAPPC4 Antibody

Name TRAPPC4 Antibody
Supplier Novus Biologicals
Catalog NBP2-13476
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: HCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIR CELFDQNLKLALEVAEKAGT
Purity/Format Immunogen affinity purified
Blocking Peptide TRAPPC4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TRAPPC4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.