TMEM55B Antibody
| Name | TMEM55B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13453 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TMEM55B Protein |
| Description | Rabbit Polyclonal |
| Gene | TMEM55B |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: TMEM55B Antibody [NBP2-13453] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23452_TMEM55B-Antibody-Immunohistochemistry-Paraffin-NBP2-13453-img0001.jpg)
![Western Blot: TMEM55B Antibody [NBP2-13453] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2895_TMEM55B-Antibody-Western-Blot-NBP2-13453-img0004.jpg)