USP38 Antibody

Name USP38 Antibody
Supplier Novus Biologicals
Catalog NBP2-13510
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: YSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVFEQDLENKE MSKEWFLFNDSRVTFTSFQSVQ
Purity/Format Immunogen affinity purified
Blocking Peptide USP38 Protein
Description Rabbit Polyclonal
Gene USP38
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.