ZNF167 Antibody

Name ZNF167 Antibody
Supplier Novus Biologicals
Catalog NBP2-13555
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPS GDFAQCTSPVPTLPQVGNSGDQAG
Purity/Format Immunogen affinity purified
Blocking Peptide ZNF167 Protein
Description Rabbit Polyclonal
Gene ZKSCAN7
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.