DDX31 Antibody
| Name | DDX31 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13905 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDKSHDQLNPKDKAVQEVCPPPAGDKLDSFAIPESLKQHVTVVPSKLRLV CLAAFILQKCKFEEDQKMVVFFSSCELV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDX31 Protein |
| Description | Rabbit Polyclonal |
| Gene | DDX31 |
| Supplier Page | Shop |
![Immunohistochemistry-Paraffin: DDX31 Antibody [NBP2-13905] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23542_DDX31-Antibody-Immunohistochemistry-Paraffin-NBP2-13905-img0001.jpg)
![Western Blot: DDX31 Antibody [NBP2-13905] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2840_DDX31-Antibody-Western-Blot-NBP2-13905-img0004.jpg)