PWWP2A Antibody

Name PWWP2A Antibody
Supplier Novus Biologicals
Catalog NBP2-13833
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: QSNTFQEGTEVKCEANGAVPDDPSPVPHPELSLAESLWTSKPPPLFHEGA PYPPPLFIRDTYNQSIPQPPP
Purity/Format Immunogen affinity purified
Blocking Peptide PWWP2A Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PWWP2A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.