CYB5RL Antibody
| Name | CYB5RL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13889 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLPWSYQEKTHFGHLGQDLIKELVSCCRRKPFALVCGSAEFTKDIARCLL CAGLTEDSYFLF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CYB5RL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CYB5RL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CYB5RL Antibody [NBP2-13889] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25609_CYB5RL%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13889-img0006.jpg)
Immunocytochemistry/Immunofluorescence: CYB5RL Antibody [NBP2-13889] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: CYB5RL Antibody [NBP2-13889] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25610_CYB5RL-Antibody-Immunohistochemistry-Paraffin-NBP2-13889-img0004.jpg)
Immunohistochemistry-Paraffin: CYB5RL Antibody [NBP2-13889] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.