COX4NB Antibody
| Name | COX4NB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13864 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTL FVD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | COX4NB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EMC8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: COX4NB Antibody [NBP2-13864] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26050_COX4NB%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13864-img0005.jpg)
Immunocytochemistry/Immunofluorescence: COX4NB Antibody [NBP2-13864] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
![Immunohistochemistry-Paraffin: COX4NB Antibody [NBP2-13864] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26051_COX4NB-Antibody-Immunohistochemistry-Paraffin-NBP2-13864-img0004.jpg)
Immunohistochemistry-Paraffin: COX4NB Antibody [NBP2-13864] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
![Immunocytochemistry/Immunofluorescence: COX4NB Antibody [NBP2-13864] - Staining of human cell line U-2 OS shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26052_COX4NB-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13864-img0003.jpg)
Immunocytochemistry/Immunofluorescence: COX4NB Antibody [NBP2-13864] - Staining of human cell line U-2 OS shows positivity in mitochondria.