GIPC2 Antibody
| Name | GIPC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14049 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGGVIDSVKTICVGDHIESINGENIVGWRHYDVAKKLKELKKEELFTMKL IEPKKAFEIELRSKAGKSSGE |
| Description | Rabbit Polyclonal |
| Gene | GIPC2 |
| Supplier Page | Shop |
Product images
![Western Blot: GIPC2 Antibody [NBP2-14049] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23615_GIPC2%2520Antibody-Western%2520Blot-NBP2-14049-img0003.jpg)
Western Blot: GIPC2 Antibody [NBP2-14049] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: GIPC2 Antibody [NBP2-14049] - Staining of human kidney shows distinct cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23616_GIPC2-Antibody-Immunohistochemistry-Paraffin-NBP2-14049-img0001.jpg)
Immunohistochemistry-Paraffin: GIPC2 Antibody [NBP2-14049] - Staining of human kidney shows distinct cytoplasmic positivity in cells in tubules.