GDPD2 Antibody
| Name | GDPD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14042 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: RANVQRRAPGMRQIYGRQGGNRTERPQFLNLPYQDLPLLDIKALHKDNVS VNLFVVN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GDPD2 Protein |
| Description | Rabbit Polyclonal |
| Gene | GDPD2 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: GDPD2 Antibody [NBP2-14042] Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23619_GDPD2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14042-img0003.jpg)
![Immunohistochemistry-Paraffin: GDPD2 Antibody [NBP2-14042] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23620_GDPD2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14042-img0001.jpg)