FAM3C Antibody
| Name | FAM3C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13995 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANV V |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM3C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM3C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM3C Antibody [NBP2-13995] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11745_FAM3C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13995-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FAM3C Antibody [NBP2-13995] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
![Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13995] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11746_FAM3C-Antibody-Immunohistochemistry-Paraffin-NBP2-13995-img0004.jpg)
Immunohistochemistry-Paraffin: FAM3C Antibody [NBP2-13995] - Staining of human hippocampus shows strong granular cytoplasmic positivity in neurons.