FAM214B Antibody
| Name | FAM214B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13993 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSQPPVRQGALQGGLLMGYSPAGGATSPGVYQVSIFSPPAGTSEPHRALK RQAPSTEGPRELKRGPGLGAREGLPPEEPSTV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM214B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM214B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM214B Antibody [NBP2-13993] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11822_FAM214B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13993-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FAM214B Antibody [NBP2-13993] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
![Immunohistochemistry-Paraffin: FAM214B Antibody [NBP2-13993] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11823_FAM214B-Antibody-Immunohistochemistry-Paraffin-NBP2-13993-img0004.jpg)
Immunohistochemistry-Paraffin: FAM214B Antibody [NBP2-13993] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.