FAM170b Antibody
| Name | FAM170b Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13985 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVL SAQQQEKQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM170b Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM170B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM170b Antibody [NBP2-13985] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11796_FAM170b%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13985-img0002.jpg)
Immunocytochemistry/Immunofluorescence: FAM170b Antibody [NBP2-13985] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and mitochondria.
![Immunohistochemistry-Paraffin: FAM170b Antibody [NBP2-13985] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11797_FAM170b%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13985-img0001.jpg)
Immunohistochemistry-Paraffin: FAM170b Antibody [NBP2-13985] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.