FAM125B Antibody
| Name | FAM125B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13979 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: QSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDA DLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM125B Protein |
| Description | Rabbit Polyclonal |
| Gene | MVB12B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM125B Antibody [NBP2-13979] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29075_FAM125B-Antibody-Western-Blot-NBP2-13979-img0003.jpg)
Western Blot: FAM125B Antibody [NBP2-13979] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: FAM125B Antibody [NBP2-13979] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29076_FAM125B-Antibody-Immunohistochemistry-Paraffin-NBP2-13979-img0004.jpg)
Immunohistochemistry-Paraffin: FAM125B Antibody [NBP2-13979] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
![Immunofluorescence: FAM125B Antibody [NBP2-13979] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29077_FAM125B-Antibody-Immunofluorescence-NBP2-13979-img0005.jpg)
Immunofluorescence: FAM125B Antibody [NBP2-13979] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.