ESF1 Antibody
| Name | ESF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13971 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: AEMALLMMDEDEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELIEDDFEV NVNDARFQAMYTSHLFNLDPSDPNFKKTKAME |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ESF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ESF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ESF1 Antibody [NBP2-13971] - Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20030_ESF1-Antibody-Immunohistochemistry-NBP2-13971-img0001.jpg)
Immunohistochemistry: ESF1 Antibody [NBP2-13971] - Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islets of Langerhans.