FSTL5 Antibody
| Name | FSTL5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14028 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLGFQDEVCPKAEGDE VQRCVWASAVNVKDKFIYVAQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FSTL5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FSTL5 |
| Supplier Page | Shop |
Product images
![Western Blot: FSTL5 Antibody [NBP2-14028] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412657)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23680_FSTL5%2520Antibody-Western%2520Blot-NBP2-14028-img0003.jpg)
Western Blot: FSTL5 Antibody [NBP2-14028] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412657)
![Immunohistochemistry-Paraffin: FSTL5 Antibody [NBP2-14028] - Staining of human kidney shows strong cytoplasmic positivity in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23681_FSTL5-Antibody-Immunohistochemistry-Paraffin-NBP2-14028-img0001.jpg)
Immunohistochemistry-Paraffin: FSTL5 Antibody [NBP2-14028] - Staining of human kidney shows strong cytoplasmic positivity in tubules.