HIGD2A Antibody
| Name | HIGD2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14092 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTREN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HIGD2A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HIGD2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HIGD2A Antibody [NBP2-14092] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11897_HIGD2A%2520Antibody-Western%2520Blot-NBP2-14092-img0004.jpg)
![Immunohistochemistry-Paraffin: HIGD2A Antibody [NBP2-14092] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11898_HIGD2A-Antibody-Immunohistochemistry-Paraffin-NBP2-14092-img0001.jpg)