HHIPL1 Antibody
| Name | HHIPL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14090 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVDRKERGLPYGIPPDNPFVGDPAAQPEVYALGVRNMWRCSFDRGDPSSG T |
| Description | Rabbit Polyclonal |
| Gene | HHIPL1 |
| Supplier Page | Shop |
![Western Blot: HHIPL1 Antibody [NBP2-14090] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23698_HHIPL1%2520Antibody-Western%2520Blot-NBP2-14090-img0003.jpg)
![Immunohistochemistry-Paraffin: HHIPL1 Antibody [NBP2-14090] - Staining of human stomach, lower shows membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23699_HHIPL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14090-img0001.jpg)