HOXB7 Antibody
| Name | HOXB7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14098 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HOXB7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOXB7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HOXB7 Antibody [NBP2-14098] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13679_HOXB7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14098-img0002.jpg)
Immunocytochemistry/Immunofluorescence: HOXB7 Antibody [NBP2-14098] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli and cytoplasm.
![Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human urinary bladder shows strong cytoplasmic, membranous and nuclear positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13680_HOXB7-Antibody-Immunohistochemistry-Paraffin-NBP2-14098-img0001.jpg)
Immunohistochemistry-Paraffin: HOXB7 Antibody [NBP2-14098] - Staining of human urinary bladder shows strong cytoplasmic, membranous and nuclear positivity in urothelial cells.