AMIGO Antibody
| Name | AMIGO Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14287 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCD TKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AMIGO Protein |
| Description | Rabbit Polyclonal |
| Gene | AMIGO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: AMIGO Antibody [NBP2-14287] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15997_AMIGO-Antibody-Western-Blot-NBP2-14287-img0004.jpg)
Western Blot: AMIGO Antibody [NBP2-14287] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: AMIGO Antibody [NBP2-14287] - Staining of human cell line BJ shows localization to nucleoplasm & nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15998_AMIGO-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14287-img0006.jpg)
Immunocytochemistry/Immunofluorescence: AMIGO Antibody [NBP2-14287] - Staining of human cell line BJ shows localization to nucleoplasm & nuclear bodies.
![Immunohistochemistry-Paraffin: AMIGO Antibody [NBP2-14287] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15999_AMIGO-Antibody-Immunohistochemistry-Paraffin-NBP2-14287-img0005.jpg)
Immunohistochemistry-Paraffin: AMIGO Antibody [NBP2-14287] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.