Als2 Antibody
| Name | Als2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14284 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSY LALVDKNIMGYIASLHELATTERRFYSKLSD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Als2 Protein |
| Description | Rabbit Polyclonal |
| Gene | ALS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10106_Als2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14284-img0005.jpg)
Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
![Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10107_Als2-Antibody-Immunohistochemistry-Paraffin-NBP2-14284-img0004.jpg)
Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.