FAM119B Antibody
| Name | FAM119B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14233 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQR DEDENVNIYRARHREPRPA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM119B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | METTL21B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FAM119B Antibody [NBP2-14233] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19942_FAM119B%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14233-img0001.jpg)
Immunohistochemistry-Paraffin: FAM119B Antibody [NBP2-14233] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.