ABCG4 Antibody
| Name | ABCG4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14252 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: NPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDPIESHTFATST LT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ABCG4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ABCG4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: ABCG4 Antibody [NBP2-14252] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11287_ABCG4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14252-img0002.jpg)
![Immunohistochemistry-Paraffin: ABCG4 Antibody [NBP2-14252] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11288_ABCG4%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14252-img0001.jpg)