C19orf25 Antibody
| Name | C19orf25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14391 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GEQLYQQSRAYVAANQRLQQAGNVLRQRCELLQRAGEDLEREVAQMKQAA LPAAEAASSG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C19orf25 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C19orf25 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C19orf25 Antibody [NBP2-14391] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26389_C19orf25-Antibody-Western-Blot-NBP2-14391-img0003.jpg)
Western Blot: C19orf25 Antibody [NBP2-14391] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunohistochemistry-Paraffin: C19orf25 Antibody [NBP2-14391] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in superficial cells of squamous epithelia.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26390_C19orf25-Antibody-Immunohistochemistry-Paraffin-NBP2-14391-img0001.jpg)
Immunohistochemistry-Paraffin: C19orf25 Antibody [NBP2-14391] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in superficial cells of squamous epithelia.