Calpain 13 Antibody
| Name | Calpain 13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14435 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLY LTEMEWMSLVMYN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Calpain 13 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CAPN13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Calpain 13 Antibody [NBP2-14435] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9086_Calpain%252013%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14435-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Calpain 13 Antibody [NBP2-14435] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: Calpain 13 Antibody [NBP2-14435] - Staining of human bronchus shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9087_Calpain%252013%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14435-img0001.jpg)
Immunohistochemistry-Paraffin: Calpain 13 Antibody [NBP2-14435] - Staining of human bronchus shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells.