FLJ37543 Antibody
| Name | FLJ37543 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14418 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: VFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKSTP IPILGVAM |
| Description | Rabbit Polyclonal |
| Gene | C5orf64 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FLJ37543 Antibody [NBP2-14418] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23931_FLJ37543%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14418-img0002.jpg)
Immunocytochemistry/Immunofluorescence: FLJ37543 Antibody [NBP2-14418] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: FLJ37543 Antibody [NBP2-14418] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/23932_FLJ37543%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14418-img0001.jpg)
Immunohistochemistry-Paraffin: FLJ37543 Antibody [NBP2-14418] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.