CDKN2A Interacting protein N-Terminal Like Antibody

Name CDKN2A Interacting protein N-Terminal Like Antibody
Supplier Novus Biologicals
Catalog NBP2-14466
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: RLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSE LMK
Purity/Format Immunogen affinity purified
Blocking Peptide CDKN2A Interacting protein N-Terminal Like Protein
Description Rabbit Polyclonal
Gene CDKN2AIPNL
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.