NKX1-2 Antibody
| Name | NKX1-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14498 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: TYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NKX1-2 Protein |
| Description | Rabbit Polyclonal |
| Gene | NKX1-2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NKX1-2 Antibody [NBP2-14498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26824_NKX1-2%2520Antibody-Western%2520Blot-NBP2-14498-img0003.jpg)
Western Blot: NKX1-2 Antibody [NBP2-14498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunohistochemistry-Paraffin: NKX1-2 Antibody [NBP2-14498] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26825_NKX1-2-Antibody-Immunohistochemistry-Paraffin-NBP2-14498-img0001.jpg)
Immunohistochemistry-Paraffin: NKX1-2 Antibody [NBP2-14498] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.