C17orf62 Antibody

Name C17orf62 Antibody
Supplier Novus Biologicals
Catalog NBP2-14553
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: MVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQ SSDSEAGDPASQS
Purity/Format Immunogen affinity purified
Blocking Peptide C17orf62 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene C17orf62
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.