CCDC72 Antibody
| Name | CCDC72 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14594 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC72 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMA7 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CCDC72 Antibody [NBP2-14594] - Staining of human cell line MCF-7 shows positivity in nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24040_CCDC72%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14594-img0002.jpg)
![Immunohistochemistry-Paraffin: CCDC72 Antibody [NBP2-14594] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24041_CCDC72%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14594-img0001.jpg)