PCIF1 Antibody
| Name | PCIF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13740 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSLVETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSI PGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PCIF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PCIF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25722_PCIF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13740-img0005.jpg)
Immunocytochemistry/Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human stomach, lower shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25723_PCIF1-Antibody-Immunohistochemistry-Paraffin-NBP2-13740-img0004.jpg)
Immunohistochemistry-Paraffin: PCIF1 Antibody [NBP2-13740] - Staining of human stomach, lower shows strong nuclear positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli, cytoskeleton (actin filaments) and cytoskeleton (cytokinetic bridge).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25724_PCIF1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13740-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PCIF1 Antibody [NBP2-13740] - Staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli, cytoskeleton (actin filaments) and cytoskeleton (cytokinetic bridge).