PAF1 Antibody
| Name | PAF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13724 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVMPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDE EGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PAF1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PEX2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PAF1 Antibody [NBP2-13724] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24064_PAF1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13724-img0002.jpg)
Immunocytochemistry/Immunofluorescence: PAF1 Antibody [NBP2-13724] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and mitochondria.
![Immunohistochemistry-Paraffin: PAF1 Antibody [NBP2-13724] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24065_PAF1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13724-img0001.jpg)
Immunohistochemistry-Paraffin: PAF1 Antibody [NBP2-13724] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.