PEX11B Antibody
| Name | PEX11B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13750 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAY EIRLLMEQESSACSRRLKGSGGG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PEX11B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PEX11B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PEX11B Antibody [NBP2-13750] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22497_PEX11B-Antibody-Western-Blot-NBP2-13750-img0003.jpg)
![Immunohistochemistry-Paraffin: PEX11B Antibody [NBP2-13750] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22498_PEX11B-Antibody-Immunohistochemistry-Paraffin-NBP2-13750-img0001.jpg)