PXMP4 Antibody
| Name | PXMP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14703 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: FEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PXMP4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PXMP4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PXMP4 Antibody [NBP2-14703] - Staining of human cell line CACO-2 shows localization to nucleoli fibrillar center & peroxisomes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11790_PXMP4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14703-img0005.jpg)
![Immunohistochemistry-Paraffin: PXMP4 Antibody [NBP2-14703] - Staining of human lung shows cytoplasmic positivity in pneumocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11791_PXMP4%2520Antibody-Immunohistochemistry-Paraffin-NBP2-14703-img0006.jpg)