ST6GALNAC3 Antibody
| Name | ST6GALNAC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31603 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EVNFPLLLNCFGQPGTKWIPFSYTYRRPLRTHYGYINVKTQEPLQLDCDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ST6GALNAC3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ST6GALNAC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST6GALNAC3 Antibody [NBP2-31603] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15137_ST6GALNAC3-Antibody-Western-Blot-NBP2-31603-img0007.jpg)
Western Blot: ST6GALNAC3 Antibody [NBP2-31603] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-MEL-30
![Immunocytochemistry/Immunofluorescence: ST6GALNAC3 Antibody [NBP2-31603] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15138_ST6GALNAC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31603-img0008.jpg)
Immunocytochemistry/Immunofluorescence: ST6GALNAC3 Antibody [NBP2-31603] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry: ST6GALNAC3 Antibody [NBP2-31603] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15139_ST6GALNAC3-Antibody-Immunohistochemistry-NBP2-31603-img0001.jpg)
Immunohistochemistry: ST6GALNAC3 Antibody [NBP2-31603] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.