NAP1L2 Antibody
| Name | NAP1L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31659 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NAP1L2 Protein |
| Description | Rabbit Polyclonal |
| Gene | NAP1L2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: NAP1L2 Antibody [NBP2-31659] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24217_NAP1L2-Antibody-Immunohistochemistry-NBP2-31659-img0001.jpg)
Immunohistochemistry: NAP1L2 Antibody [NBP2-31659] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
![Immunohistochemistry: NAP1L2 Antibody [NBP2-31659] - prostate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24218_NAP1L2-Antibody-Immunohistochemistry-NBP2-31659-img0002.jpg)
Immunohistochemistry: NAP1L2 Antibody [NBP2-31659] - prostate
![Western Blot: NAP1L2 Antibody [NBP2-31659] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Cerebral Cortex](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29963_NAP1L2%2520Antibody-Western%2520Blot-NBP2-31659-img0007.jpg)
Western Blot: NAP1L2 Antibody [NBP2-31659] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Cerebral Cortex
![Immunohistochemistry: NAP1L2 Antibody [NBP2-31659] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/29964_NAP1L2-Antibody-Immunohistochemistry-NBP2-31659-img0006.jpg)
Immunohistochemistry: NAP1L2 Antibody [NBP2-31659] - liver cancer