Uroplakin II Antibody
| Name | Uroplakin II Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33389 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Uroplakin II Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | UPK2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of tonsil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6677_Uroplakin-II-Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0002.jpg)
Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of tonsil.
![Immunohistochemistry: Uroplakin II Antibody [NBP2-33389] - Staining of human urinary bladder shows strong cytoplasmic positivity in umbrella cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6678_Uroplakin-II-Antibody-Immunohistochemistry-NBP2-33389-img0001.jpg)
Immunohistochemistry: Uroplakin II Antibody [NBP2-33389] - Staining of human urinary bladder shows strong cytoplasmic positivity in umbrella cells.
![Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6679_Uroplakin%2520II%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33389-img0003.jpg)
Immunohistochemistry-Paraffin: Uroplakin II Antibody [NBP2-33389] - Staining of liver cancer.