C17orf39 Antibody
| Name | C17orf39 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91717 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C17orf39 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GID4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C17orf39 Antibody [NBP1-91717] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24958_C17orf39%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91717-img0006.jpg)
Immunocytochemistry/Immunofluorescence: C17orf39 Antibody [NBP1-91717] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
![Immunohistochemistry-Paraffin: C17orf39 Antibody [NBP1-91717] - Staining of human testis shows cytoplasmic positivity in cells of seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24959_C17orf39-Antibody-Immunohistochemistry-Paraffin-NBP1-91717-img0005.jpg)
Immunohistochemistry-Paraffin: C17orf39 Antibody [NBP1-91717] - Staining of human testis shows cytoplasmic positivity in cells of seminiferous ducts.