Aspartyl Aminopeptidase Antibody
| Name | Aspartyl Aminopeptidase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91684 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SCFCALQALIDSCAGPGSLATEPHVRMVTLYDNEEVGSESAQGAQSLLTELVLRRISASCQHPTAFEEAIPKSFMISADMAHAVHPNYLD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Aspartyl Aminopeptidase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DNPEP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-49](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13607_Aspartyl-Aminopeptidase-Antibody-Western-Blot-NBP1-91684-img0004.jpg)
Western Blot: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-49
![Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human liver shows strong nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13608_Aspartyl-Aminopeptidase-Antibody-Immunohistochemistry-Paraffin-NBP1-91684-img0001.jpg)
Immunohistochemistry-Paraffin: Aspartyl Aminopeptidase Antibody [NBP1-91684] - Staining of human liver shows strong nuclear positivity in hepatocytes.