HNRPLL Antibody
| Name | HNRPLL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92002 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HNRPLL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HNRNPLL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HNRPLL Antibody [NBP1-92002] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6519_HNRPLL%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92002-img0005.jpg)
Immunocytochemistry/Immunofluorescence: HNRPLL Antibody [NBP1-92002] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.
![Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP1-92002] - Staining of human fallopian tube shows nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6520_HNRPLL-Antibody-Immunohistochemistry-Paraffin-NBP1-92002-img0004.jpg)
Immunohistochemistry-Paraffin: HNRPLL Antibody [NBP1-92002] - Staining of human fallopian tube shows nuclear and cytoplasmic positivity in glandular cells.