Gasdermin-C Antibody
| Name | Gasdermin-C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91925 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSL |
| Description | Rabbit Polyclonal |
| Gene | GSDMC |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: Gasdermin-C Antibody [NBP1-91925] Staining of human cell line A-431 shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24567_Gasdermin-C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91925-img0003.jpg)
![Immunohistochemistry-Paraffin: Gasdermin-C Antibody [NBP1-91925] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24568_Gasdermin-C%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91925-img0002.jpg)