HCCA2 Antibody
| Name | HCCA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91978 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SKAKPNGKKPAAEERKAYLEPEHTKARITDFQFKELVVLPREIDLNEWLASNTTTFFHHINLQYSTISEFCT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HCCA2 Protein |
| Description | Rabbit Polyclonal |
| Gene | MOB2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HCCA2 Antibody [NBP1-91978] Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24580_HCCA2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91978-img0003.jpg)
Immunocytochemistry/Immunofluorescence: HCCA2 Antibody [NBP1-91978] Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: HCCA2 Antibody [NBP1-91978] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24581_HCCA2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91978-img0002.jpg)
Immunohistochemistry-Paraffin: HCCA2 Antibody [NBP1-91978] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.