HOXC10 Antibody
| Name | HOXC10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33699 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HOXC10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOXC10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: HOXC10 Antibody [NBP2-33699] - Immunofluorescent staining of human cell line HeLa shows localization to nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10384_HOXC10%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33699-img0005.jpg)
![Immunohistochemistry: HOXC10 Antibody [NBP2-33699] - Staining of human vulva/anal skin moderate nuclear positivity in epidermal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10385_HOXC10-Antibody-Immunohistochemistry-NBP2-33699-img0001.jpg)