SRPR alpha Antibody
| Name | SRPR alpha Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33695 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LSALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SRPR alpha Protein |
| Description | Rabbit Polyclonal |
| Gene | SRPR |
| Supplier Page | Shop |
![Immunohistochemistry: SRPR alpha Antibody [NBP2-33695] - bronchus](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24762_SRPR-alpha-Antibody-Immunohistochemistry-NBP2-33695-img0002.jpg)
![Immunohistochemistry: SRPR alpha Antibody [NBP2-33695] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24763_SRPR-alpha-Antibody-Immunohistochemistry-NBP2-33695-img0001.jpg)
![Immunohistochemistry: SRPR alpha Antibody [NBP2-33695] - carcinoid](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24764_SRPR%2520alpha%2520Antibody-Immunohistochemistry-NBP2-33695-img0003.jpg)